PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011084049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 384aa    MW: 43344.9 Da    PI: 6.4076
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011084049.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.68.7e-083213542154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e++++L +++gL+ +q+ +WF N+R +
  XP_011084049.1 321 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 354
                     469*****************************87 PP

2ELK292.4e-10275296122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+++++++++E++
  XP_011084049.1 275 ELKHELKQGYKEKIVDIREEIL 296
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.1E-20109153IPR005540KNOX1
PfamPF037909.2E-18111152IPR005540KNOX1
SMARTSM012567.6E-25163218IPR005541KNOX2
PfamPF037911.5E-18168217IPR005541KNOX2
SMARTSM011886.1E-4275296IPR005539ELK domain
PROSITE profilePS512139.969275295IPR005539ELK domain
PfamPF037898.7E-7275296IPR005539ELK domain
PROSITE profilePS5007111.726295358IPR001356Homeobox domain
SuperFamilySSF466894.28E-16297361IPR009057Homeodomain-like
SMARTSM003892.4E-11297362IPR001356Homeobox domain
CDDcd000867.62E-12298359No hitNo description
Gene3DG3DSA:1.10.10.602.5E-25302359IPR009057Homeodomain-like
PfamPF059201.0E-17315354IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MAFQDHHHHH HLSQEMPLHL PRYSDHHNPP SAAAVFSSIL PDHHQSPDEK PPPTTTAWLN  60
SSTFHHQWLS TPSPPRPPDN SDHPQDSGGG GGGDNSNNSN GNNTNWEKEK CKADILSHPL  120
YEQLLSAHVA CLRIATPVDQ LPRIDAQLDQ SHQVVAKYSV LGHGQPPLDD KDLDHFMTHY  180
VLLLSSFKEQ LQQHVRVHAM EAVMACWELE QSLQSLTGVA PGEGTGATMS DDDEDQADSE  240
MNLFDESLDG PDSMGFGPLV PTESERSLME RVRQELKHEL KQGYKEKIVD IREEILRKRR  300
AGKLPGDTTS VLKAWWQSHS KWPYPTEEDK ARLVQETGLQ LKQINNWFIN QRKRNWHSNP  360
SSSTSQKTKR KNGAGDKTAN DRFT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12298362872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084049.10.0PREDICTED: homeobox protein knotted-1-like LET12 isoform X1
SwissprotP480001e-171KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A022QCD30.0A0A022QCD3_ERYGU; Uncharacterized protein
STRINGVIT_04s0008g06130.t011e-175(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-170KNOTTED1-like homeobox gene 3